PXD070993 is an
original dataset announced via ProteomeXchange.
Dataset Summary
| Title | N8-propargyl spermidine as a chemical probe for sensing of ALDH1A1 activity in cells |
| Description | A549 cells were incubated with N8-propargyl spermidine, N1-propargyl spermidine, or native spermidine. Protein conjugates formed in cellulo were analyzed as follows. After cell lysis, probe-protein adducts were subjected to bioorthogonal CuAAC ligation and affinity enrichment on NeutrAvidin beads. The enriched proteins were digested with trypsin, and the resulting peptides were labeled with TMT. Proteins that showed enrichment in samples treated with the propargyl analogs versus spermidine were designated as analog-binding proteins. This analysis revealed specific covalent binding of N8-propargyl spermidine to ALDH1A1. In a complementary peptide-level workflow, CuAAC ligation to azide-PEG3-biotin was followed by tryptic digestion, capture of biotinylated peptides bearing the probe or its metabolic products, and LC-MS/MS analysis. Dependent peptide analysis identified modification on the ALDH1A1 peptide SPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASR (positions 274–308). Site-localization analysis placed the modification within the GQCC segment (positions 301–304), with nucleophilic Cys303 in the catalytic center being a highly probable site. Further experiments showed that the binding is ALDH1A1 activity dependent. |
| HostingRepository | PRIDE |
| AnnounceDate | 2026-05-28 |
| AnnouncementXML | Submission_2026-05-28_03:27:00.526.xml |
| DigitalObjectIdentifier | |
| ReviewLevel | Peer-reviewed dataset |
| DatasetOrigin | Original dataset |
| RepositorySupport | Unsupported dataset by repository |
| PrimarySubmitter | Remigiusz Serwa |
| SpeciesList | scientific name: Homo sapiens (Human); NCBI TaxID: NEWT:9606; |
| ModificationList | acetylated residue; monohydroxylated residue; iodoacetamide derivatized residue |
| Instrument | Q Exactive HF-X |
Dataset History
| Revision | Datetime | Status | ChangeLog Entry |
|---|
| 0 | 2025-11-20 07:47:23 | ID requested | |
| ⏵ 1 | 2026-05-28 03:27:01 | announced | |
Publication List
Keyword List
| submitter keyword: chemical probe,ALDH1A1, A549, activity-based probe, N8-propargyl spermidine |
Contact List
| Remigiusz Serwa |
|---|
| contact affiliation | IMol, Polish Academy of Sciences, M. Flisa 6, 02-247 Warsaw, Poland |
| contact email | r.serwa@imol.edu.pl |
| lab head | |
| Remigiusz Serwa |
|---|
| contact affiliation | The International Institute of Molecular Mechanisms and Machines, Polish Academy of Sciences |
| contact email | r.serwa@imol.edu.pl |
| dataset submitter | |
Full Dataset Link List
Dataset FTP location
NOTE: Most web browsers have now discontinued native support for FTP access within the browser window. But you can usually install another FTP app (we recommend FileZilla) and configure your browser to launch the external application when you click on this FTP link. Or otherwise, launch an app that supports FTP (like FileZilla) and use this address: ftp://ftp.pride.ebi.ac.uk/pride/data/archive/2026/05/PXD070993 |
| PRIDE project URI |
Repository Record List
[ + ]
[ - ]
- PRIDE
- PXD070993
- Label: PRIDE project
- Name: N8-propargyl spermidine as a chemical probe for sensing of ALDH1A1 activity in cells
